PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G338000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 342aa    MW: 38167.4 Da    PI: 5.6932
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G338000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-171461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  Aqcoe3G338000.1.p 14 KGPWTPEEDIILVSYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNYL 61
                       79******************************99************97 PP

2Myb_DNA-binding48.32.3e-1567112148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg++T  E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Aqcoe3G338000.1.p  67 RGNFTDHEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                        89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-23564IPR009057Homeodomain-like
PROSITE profilePS5129424.33965IPR017930Myb domain
SuperFamilySSF466893.11E-3011108IPR009057Homeodomain-like
SMARTSM007172.0E-141363IPR001005SANT/Myb domain
PfamPF002493.5E-161461IPR001005SANT/Myb domain
CDDcd001671.25E-111661No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129419.21666116IPR017930Myb domain
SMARTSM007174.0E-1566114IPR001005SANT/Myb domain
PfamPF002498.9E-1467112IPR001005SANT/Myb domain
CDDcd001671.42E-1069111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDIILVSYIQ EHGPGNWRAV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TDHEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKLQ  120
TGLDGQNRDG FSSFQPSITK GQWERRLQTD IHTAKKALCD ALSLDDTKPS NSCLSELKAS  180
NGYYSLTRSS QPSQSSTTYA SSTENISRLL EGWMANAPKP AQTNSETTQF SFNNVTGTDS  240
SSEECTPTAT NNNEMVSQGA FDSLFALDSS TPDVSPSLSL DESTQFQSET NFFQDESKPS  300
FETPVPFSML EKWLFDESLI AQGHEALNIQ QISLDDNVNL F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C9e-26141164105C-Myb DNA-Binding Domain
1msf_C9e-26141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00395DAPTransfer from AT3G47600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010258354.11e-177PREDICTED: myb-related protein 306
SwissprotP813921e-126MYB06_ANTMA; Myb-related protein 306
TrEMBLF6H5T61e-147F6H5T6_VITVI; Putative uncharacterized protein
TrEMBLM5WUN21e-147M5WUN2_PRUPE; Uncharacterized protein
STRINGVIT_14s0108g00830.t011e-147(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.17e-99myb domain protein 94